PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g051060.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 285aa    MW: 32151.8 Da    PI: 8.4661
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g051060.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32113166255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Sopim05g051060.0.1 113 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 166
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-15110166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28111166IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23113166IPR006447Myb domain, plants
PfamPF002491.3E-7114165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MNSYHGVSLL DPIKGIPIYH HHQDPKRSSS FGSIYHNNLD HISYSNNSYV TNVASSSPYN  60
RIPIVANRFQ NQQHIYYNGV GLLGSPSSHE SNNFLMRSRF LPKFPTKRSM RAPRMRWTTS  120
LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPAASSDGS  180
GEEDLLAIDK ILDQRGPLDG CDEPSTTLWS NSSSSRERLS QANFNESNGL IRSSSFPSQQ  240
RFSHHIEECE YSRAMSYVGC SLDQKNPSLE FTLGRSDWVE KNHD*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2395830.0AC239583.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 5 clone C05HBa0201O22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240040.10.0PREDICTED: transcription repressor KAN1-like isoform X1
SwissprotQ93WJ91e-69KAN1_ARATH; Transcription repressor KAN1
TrEMBLK4C1D80.0K4C1D8_SOLLC; Uncharacterized protein
STRINGSolyc05g051060.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-65G2-like family protein